IP address details

173.208.84.80

Chicago, Illinois, United States

Need more data or want to access it via API or data downloads? Sign up to get free access

Sign up for free ›

Summary

ASN AS27411 - Leaseweb USA, Inc.
Hostname falklandislandsislasmalvinas.findermastery.com
Range 173.208.80.0/21
Company LeaseWeb USA, Inc. Chicago
Hosted domains 0
Privacy True
Anycast False
ASN type Hosting
Abuse contact abuse@us.leaseweb.com

IP Geolocation

City Chicago
State Illinois
Country United States
Postal 60666
Local time 07:03 AM, Friday, September 13, 2024
Timezone America/Chicago
Coordinates 41.8500,-87.6500
41.8500,-87.6500

IP Geolocation data

IP geolocation lookup is the identification of an IP address' geographic location in the real world.

Privacy Detection

VPN
Proxy
Tor
Relay
Hosting

Privacy Detection data

Detects various methods used to mask a user's true IP address, including VPN detection, proxy detection, tor usage, relay usage, or a connection via a hosting provider.

ASN

AS27411 - Leaseweb USA, Inc.
Domain
leaseweb.com
ASN type
Hosting

ASN data

ASN details for every IP address and every ASN’s related domains, allocation date, registry name, total number of IP addresses, and assigned prefixes.
Useful for Cybersecurity

Company

LeaseWeb USA, Inc. Chicago

Company API

Provides the company behind the IP address. This includes the company’s name, domain name, and what type of company it is: ISP, business, or hosting.).

Abuse Details

US, VA, Manassas, 9480 Innovation Dr, 20109
+1-571-814-3777
Name
Leaseweb US abuse dept
Network
173.208.80.0/21

Abuse Contact data

Our abuse contact API returns data containing information belonging to the abuse contact of every IP address on the Internet.
Useful for Cybersecurity

An API built with users in mind: reliable, accurate, and easy-to-use

Discover why industry-leading companies around the globe love our data. IPinfo's accurate insights fuel use cases from cybersecurity, data enrichment, web personalization, and much more.

IPinfo for all your IP geolocation needs

Our IP tools

Explore all tools
What is my IP

What is my IP

Test our data accuracy by viewing insights from your IP address.

See your IP address
Map IPs

Map IPs

Paste up to 500,000 IPs to see where they're located on a map.

Try Map IPs
Summarize IPs

Summarize IPs

Use our data visualization tool to create a visual overview of multiple IPs.

Try Summarize IPs